A database of hormones and their receptors

Home

Hormone Peptide Non-peptide Search Search Browse Browse H-R Pair H-R Pair

Receptor Search Browse

Tools BLAST Domain Search Peptide Mapping Structure Search

Miscellaneous Online Submission HMRbase Information Supplementary Information Recent Information Help

Contact

Peptide Hormone

Search Result - 1

HMRbase accession number	10619
Swiss-prot Accession number	P30970 (Sequence in FASTA format)
Description	Glycoprotein hormones alpha chain precursor (Gonadotropin alpha chain)(GTH-alpha).
Source organism	Acanthopagrus latus (Yellowfin porgy)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;Acanthomorpha; Acanthopterygii; Percomorpha; Perciformes; Percoidei;Sparidae; Acanthopagrus.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit alpha family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Involved in gametogenesis and steroidogenesis
Protein Length	117 Amino acids
Molecular weight	13061
References	1   Tsai H.J., Chen Y.L.; "Molecular cloning and sequencing of yellowfin porgy gonadotropinalpha-subunit cDNA."; Submitted (JUN-1992) to the EMBL/GenBank/DDBJ databases.
Domain Name	Hormone_6
Hormone Name	Glycoprotein hormones alpha chain
Mature Hormone Sequence	YPNTDLSNMGCEACTLRKNTVFSRDRPIYQCMGCCFSRAYPTPLKAMKTMTIPKNITSEATCCVAKHVYETEVAGIRVRNHTDCHCSTCYYHKI
Position of mature hormone in Pre-Hormone protein	94 Residues from position (24-117)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 2

HMRbase accession number	10718
Swiss-prot Accession number	P45654 (Sequence in FASTA format)
Description	Somatotropin precursor (Growth hormone).
Source organism	Acanthopagrus latus (Yellowfin porgy)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;Acanthomorpha; Acanthopterygii; Percomorpha; Perciformes; Percoidei;Sparidae; Acanthopagrus.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the somatotropin/prolactin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Growth hormone plays an important role in growth control and is involved in the regulation of several anabolic processes. Implicated as an osmoregulatory substance important for seawater adaptation
Protein Length	204 Amino acids
Molecular weight	23056
References	1  PubMed abstract 8472546
Domain Name	Hormone_1
Hormone Name	Somatotropin
Mature Hormone Sequence	QPITDGQRLFSIAVSRVQHLHLLAQRLFSDFESSLQTEEQRQLNKIFLQDFCNSDYIISPIDKHETQRSSVLKLLSISYRLVESWEFPSRSLAGGSAPRNQISPKLSELKTGIHLLIRANEDGAELFPDSSALQLAPYGDYYQSPGTDESLRRTYELLACFKKDMHKVETYLTVAKCRLSPEANCTL
Position of mature hormone in Pre-Hormone protein	187 Residues from position (18-204)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated